Return to main results Retrieve Phyre Job Id

Job DescriptionQ46795
Confidence1.61%DateThu Jan 5 12:34:15 GMT 2012
Rank75Aligned Residues42
% Identity33%Templatec2i6hA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein atu0120; PDBTitle: structure of protein of unknown function atu0120 from agrobacterium2 tumefaciens
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   70.........80.........90.........100.........110.........120.....
Predicted Secondary structure 


















Query SS confidence 























































Query Sequence  TLLPYIRQQPLAMQQRFNLLFPDFVDHIQSPLPLASTLLERITFYAKKNRDELDKI
Query Conservation   

  
  

 

 


 



   
     

   






 


         
Alig confidence 


























..............














Template Conservation   



 


 
  
   
 
   
   ..............    
  
  

 

Template Sequence  FYLPFSHAEDIAAQQRACDLNQPLGGL. . . . . . . . . . . . . . YLHHAEEHRDIVERF
Template Known Secondary structure  GTTSSSTTT
..............
Template Predicted Secondary structure 

..............
Template SS confidence 























































   113......120.........130......... 140.........150....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions