Return to main results Retrieve Phyre Job Id

Job DescriptionP75617
Confidence10.14%DateThu Jan 5 12:12:48 GMT 2012
Rank91Aligned Residues35
% Identity20%Templatec1txlA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:metal-binding protein yoda; PDBTitle: crystal structure of metal-binding protein yoda from e.2 coli, pfam duf149
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   72.......80... ......90.........100.........110.........120
Predicted Secondary structure 
..













Query SS confidence 











. .




































Query Sequence  HFGGDSIANKLR. . GHGKLYRAILLDVSKRLKLKADKEMSTFEIEQQLLEQ
Query Conservation   




  
  
..
 

 
 


 

  



          

  

 
Alig confidence 











..





..............
















Template Conservation    
 
   


 
   



..............
   

   
  

  
Template Sequence  FMGNDSQQSLLNEMENWPTY. . . . . . . . . . . . . . YPYQLSSEEVVEEMMSH
Template Known Secondary structure  SS
T

S


..............TTS

Template Predicted Secondary structure 










..............






Template SS confidence 


















































   179180.........190........ .200.........210.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions