Return to main results Retrieve Phyre Job Id

Job DescriptionP11071
Confidence36.53%DateThu Jan 5 11:32:28 GMT 2012
Rank9Aligned Residues19
% Identity53%Templatec3hzpA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:ntf2-like protein of unknown function; PDBTitle: crystal structure of ntf2-like protein of unknown function mn2a_05052 from prochlorococcus marinus (yp_291699.1) from prochlorococcus sp.3 natl2a at 1.40 a resolution
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   321...... ..330.........
Predicted Secondary structure  ..............





Query SS confidence 






. . . . . . . . . . . . . .











Query Sequence  MVMLVFT. . . . . . . . . . . . . . LPGFDRVFKVIK
Query Conservation 


 


..............


   





Alig confidence 






..............











Template Conservation   







  
 



 



   







Template Sequence  AAICVFTLGSKFTYKGTQNDDLPTVTSIFKKID
Template Known Secondary structure  TTB
T
Template Predicted Secondary structure 










Template SS confidence 
































   76...80.........90.........100........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions