Return to main results Retrieve Phyre Job Id

Job DescriptionP11071
Confidence27.70%DateThu Jan 5 11:32:28 GMT 2012
Rank16Aligned Residues25
% Identity28%Templatec3ff6D_
PDB info PDB header:ligaseChain: D: PDB Molecule:acetyl-coa carboxylase 2; PDBTitle: human acc2 ct domain with cp-640186
Resolution3.19 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   346...350.........360. ........370
Predicted Secondary structure  ............
Query SS confidence 















. . . . . . . . . . . .








Query Sequence  KEMSAAHVRACYQLVK. . . . . . . . . . . . EHDRVGRMA
Query Conservation 
  
   
  

 


............ 







Alig confidence 















............








Template Conservation            
   
 
 
   
  





   

 
Template Sequence  RKDLEGRLKAREDLLLPIYHQVAVQFADFHDTPGRML
Template Known Secondary structure  TTSS
Template Predicted Secondary structure 


Template SS confidence 




































   2272.......2280.........2290.........2300........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions