Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9C3
Confidence5.92%DateThu Jan 5 11:09:52 GMT 2012
Rank50Aligned Residues28
% Identity39%Templatec3nttA_
PDB info PDB header:virusChain: A: PDB Molecule:capsid protein; PDBTitle: structural insights of adeno-associated virus 5. a gene therapy vector2 for cystic fibrosis
Resolution3.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   301........310.........320.........330.........340...
Predicted Secondary structure 
























Query SS confidence 










































Query Sequence  ADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTEYQF
Query Conservation       




   


 
      
   
 


       
 
Alig confidence 








.............















..


Template Conservation   

 

 

.............
    





 
   ..
 
Template Sequence  ERSSFFCLE. . . . . . . . . . . . . YFPSKMLRTGNNFEFT. . YNF
Template Known Secondary structure  TT




GG.............GS


TT

..
Template Predicted Secondary structure 


.............








..
Template SS confidence 










































   381........ 390.........400..... ...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions