Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9C3
Confidence7.25%DateThu Jan 5 11:09:52 GMT 2012
Rank41Aligned Residues25
% Identity40%Templatec2g8gA_
PDB info PDB header:virusChain: A: PDB Molecule:capsid; PDBTitle: structurally mapping the diverse phenotype of adeno-2 associated virus serotype 4
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   304.....310.........320.........330.........340...
Predicted Secondary structure 





















Query SS confidence 







































Query Sequence  QGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTEYQF
Query Conservation    




   


 
      
   
 


       
 
Alig confidence 





.............












..





Template Conservation   

 

.............
    





 
..
  
 
Template Sequence  AFYCLE. . . . . . . . . . . . . YFPSQMLRTGNNF. . EITYSF
Template Known Secondary structure 



GG.............GS


TTB
..
Template Predicted Secondary structure 
.............







..
Template SS confidence 







































   385....390 .........400... ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions