Return to main results Retrieve Phyre Job Id

Job DescriptionP77319
Confidence95.46%DateThu Jan 5 12:27:42 GMT 2012
Rank95Aligned Residues274
% Identity16%Templatec3en9B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:o-sialoglycoprotein endopeptidase/protein kinase; PDBTitle: structure of the methanococcus jannaschii kae1-bud32 fusion2 protein
Resolution2.67 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60.........70.........80..
Predicted Secondary structure 




























Query SS confidence 















































































Query Sequence  NAELAIGIDLGTTNSLIAVWKDGAAQLIPNKFGEYLTPSIISMDENNHILVGKPAVSRRTSHPDKTAALFKRAMGSNTNW
Query Conservation      




 


 
 

        

    
    

 
          
  
               
  

     
Alig confidence 























.










............................................
Template Conservation    
 







 


 


    . 
         ............................................
Template Sequence  DPMICLGLEGTAEKTGVGIVTSDG. EVLFNKTIMYK. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Template Known Secondary structure 



SSSTTS.


............................................
Template Predicted Secondary structure 











.

............................................
Template SS confidence 















































































  
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions