Return to main results Retrieve Phyre Job Id

Job DescriptionP69346
Confidence3.73%DateThu Jan 5 12:11:23 GMT 2012
Rank61Aligned Residues34
% Identity15%Templated1t2da2
SCOP infoLDH C-terminal domain-like LDH C-terminal domain-like Lactate & malate dehydrogenases, C-terminal domain
Resolution1.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.........50.........60.........70...
Predicted Secondary structure 






Query SS confidence 















































Query Sequence  PILITRQNGEACVLMSLEEYNSLEETAYLLRSPANARRLMDSIDSLKS
Query Conservation 





      



  

 

 


 

        
  

     
Alig confidence 





















..............











Template Conservation 

 

  

  
  
 
   
 ..............  
  
   
 
Template Sequence  PVVLGANGVEQVIELQLNSEEK. . . . . . . . . . . . . . AKFDEAIAETKR
Template Known Secondary structure  TT





..............
Template Predicted Secondary structure 








..............
Template SS confidence 















































   277..280.........290........ .300.........310
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions