Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC16
Confidence1.69%DateThu Jan 5 11:16:54 GMT 2012
Rank76Aligned Residues28
% Identity25%Templatec3ff1B_
PDB info PDB header:isomeraseChain: B: PDB Molecule:glucose-6-phosphate isomerase; PDBTitle: structure of glucose 6-phosphate isomerase from staphylococcus aureus
Resolution1.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4950.........60.. .......70......
Predicted Secondary structure 


........





Query SS confidence 













. . . . . . . .













Query Sequence  DCLSYADIAETVVS. . . . . . . . HVEGARFALVERVA
Query Conservation   



  
   
  ........        


 

Alig confidence 













........













Template Conservation 

 

      
  
    

 








 

  
Template Sequence  NHLSSTYTKELVDYLADKDFSVNVISKSGTTTEPAV
Template Known Secondary structure  SS

TTS

SSS

Template Predicted Secondary structure 












Template SS confidence 



































   113......120.........130.........140........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions