Return to main results Retrieve Phyre Job Id

Job DescriptionP42910
Confidence2.93%DateThu Jan 5 12:02:07 GMT 2012
Rank56Aligned Residues42
% Identity17%Templatec2y69Q_
PDB info PDB header:electron transportChain: Q: PDB Molecule:cytochrome c oxidase subunit 4 isoform 1; PDBTitle: bovine heart cytochrome c oxidase re-refined with molecular2 oxygen
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   224.....230.........240..... ....250.........260.....
Predicted Secondary structure  .....................











Query SS confidence 





















. . . . . . . . . . . . . . . . . . . . .



















Query Sequence  NLLPVAVLGAGFAVYEFFNAKS. . . . . . . . . . . . . . . . . . . . . RQQAQPQPVASKNEEEDYSN
Query Conservation   
  


 
   
         .....................             



   
Alig confidence 





















.....................



















Template Conservation   
 
     
          
    

 
 
 
 




  


     




 






 
Template Sequence  TVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDK
Template Known Secondary structure  T




GGGSTTSSTTTTSGGGTTT
Template Predicted Secondary structure 




















Template SS confidence 






























































   80.........90.........100.........110.........120.........130.........140..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions