Return to main results Retrieve Phyre Job Id

Job DescriptionP46130
Confidence9.99%DateThu Jan 5 12:04:05 GMT 2012
Rank42Aligned Residues27
% Identity7%Templatec3owvA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:dna-entry nuclease; PDBTitle: structural insights into catalytic and substrate binding mechanisms of2 the strategic enda nuclease from streptococcus pneumoniae
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   343......350.........360.........370......
Predicted Secondary structure 
























Query SS confidence 

































Query Sequence  LGRSLDVDANTNGQVVIRDSAINEGFNTAKPWAD
Query Conservation 




   

    

   
 
   
   


  
Alig confidence 








......














.


Template Conservation 
 
   
 
...... 
 
        
 
.


Template Sequence  ETVPTVANA. . . . . . LLSKATRQYSWTPPG. WHQ
Template Known Secondary structure  ......
GGG






TT.


Template Predicted Secondary structure 



......








.
Template SS confidence 

































   107..110..... ....120.........130 ...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions