Return to main results Retrieve Phyre Job Id

Job DescriptionP46130
Confidence4.43%DateThu Jan 5 12:04:05 GMT 2012
Rank73Aligned Residues24
% Identity8%Templatec3by7E_
PDB info PDB header:unknown functionChain: E: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of a protein structurally similar to sm/lsm-like2 rna-binding proteins (jcvi_pep_1096686650277) from uncultured marine3 organism at 2.60 a resolution
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   346...350.. .......360.........
Predicted Secondary structure 






......









Query SS confidence 






. . . . . .
















Query Sequence  SLDVDAN. . . . . . TNGQVVIRDSAINEGFN
Query Conservation 

   

......    

   
 
   
 
Alig confidence 






......
















Template Conservation 





























Template Sequence  PWQPYTDDKEIVIDDSKVITITSPKDDIIK
Template Known Secondary structure  S
TT


SGGG


Template Predicted Secondary structure 













Template SS confidence 





























   51........60.........70.........80
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions