Return to main results Retrieve Phyre Job Id

Job DescriptionP46130
Confidence7.82%DateThu Jan 5 12:04:05 GMT 2012
Rank49Aligned Residues26
% Identity19%Templatec2qyvB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:xaa-his dipeptidase; PDBTitle: crystal structure of putative xaa-his dipeptidase (yp_718209.1) from2 haemophilus somnus 129pt at 2.11 a resolution
Resolution2.11 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   247..250.........260.........270.........280.... .....290..
Predicted Secondary structure 





















..



Query SS confidence 





































. .







Query Sequence  ILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDV. . DIVSGRGA
Query Conservation 
 
 




               

 

  
 


 
..




 
 
Alig confidence 












....................




..







Template Conservation 
 






  

....................
     

 
 


 
Template Sequence  LQAHLDXVPQQDP. . . . . . . . . . . . . . . . . . . . ILPYIDGDWVKAKGT
Template Known Secondary structure  S
B





....................


SSTTB
Template Predicted Secondary structure 










....................





Template SS confidence 















































   73......80..... ....90.........100
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions