Return to main results Retrieve Phyre Job Id

Job DescriptionP76162
Confidence19.96%DateThu Jan 5 12:19:57 GMT 2012
Rank35Aligned Residues33
% Identity27%Templatec2xznN_
PDB info PDB header:ribosomeChain: N: PDB Molecule:rps29e; PDBTitle: crystal structure of the eukaryotic 40s ribosomal2 subunit in complex with initiation factor 1. this file3 contains the 40s subunit and initiation factor for4 molecule 2
Resolution3.93 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   273......280.........290.........300.........310.........320.
Predicted Secondary structure 




























Query SS confidence 
















































Query Sequence  TQPCACCGMPADDPHHLIGHGQGGMGTKAHDLFVLPLCRKHHNELHTDT
Query Conservation 
 

  

  


 






 
 

 





 



   
 


 
 
Alig confidence 








....








............














Template Conservation 

 

 

 ....  






............
 







 
 

Template Sequence  SKECRVCGA. . . . RQGLITKYE. . . . . . . . . . . . MMTCRRCFREQAPHI
Template Known Secondary structure  G


TTT

....SSTT


SS............S


Template Predicted Secondary structure 




....



............
Template SS confidence 
















































   17..20..... ....30.... .....40.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions