Return to main results Retrieve Phyre Job Id

Job DescriptionP76162
Confidence11.60%DateThu Jan 5 12:19:57 GMT 2012
Rank78Aligned Residues24
% Identity29%Templatec1l7qA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:cocaine esterase; PDBTitle: ser117ala mutant of bacterial cocaine esterase coce
Resolution1.76 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   268.270.........280.........290.......
Predicted Secondary structure 


















Query SS confidence 





























Query Sequence  TRWVKTQPCACCGMPADDPHHLIGHGQGGM
Query Conservation 
  


 

  

  


 






 
 
Alig confidence 









......













Template Conservation 
 

      ......

 


 
 
 

 
Template Sequence  LSWILEQAWC. . . . . . DGNVGMFGVAYLGV
Template Known Secondary structure  STT......
T
Template Predicted Secondary structure 



......



Template SS confidence 





























   98.100....... ..110.........120.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions