Return to main results Retrieve Phyre Job Id

Job DescriptionP0CK95
Confidence43.45%DateWed Jan 25 15:20:37 GMT 2012
Rank28Aligned Residues23
% Identity35%Templatec1w5cT_
PDB info PDB header:photosynthesisChain: T: PDB Molecule:cytochrome c-550; PDBTitle: photosystem ii from thermosynechococcus elongatus
Resolution3.2 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   703......710....... ..720.....
Predicted Secondary structure 



..........



Query SS confidence 














. . . . . . . . . .







Query Sequence  PKLTQQDVTDLIAYL. . . . . . . . . . NKGGSVLI
Query Conservation 


   


 

 

..........
 




 
Alig confidence 














..........







Template Conservation    





 

  

  

       



   
Template Sequence  RNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
Template Known Secondary structure  TT

GGGGTT
SS

Template Predicted Secondary structure 

















Template SS confidence 
































   105....110.........120.........130.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions