Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6L7
Confidence11.60%DateThu Jan 5 11:03:27 GMT 2012
Rank69Aligned Residues24
% Identity38%Templated2qdya1
SCOP infoNitrile hydratase alpha chain Nitrile hydratase alpha chain Nitrile hydratase alpha chain
Resolution1.30

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   174.....180.........190.........200....
Predicted Secondary structure 






Query SS confidence 






























Query Sequence  DYNGDALRELVLRYAQEWALPEAFIQWLDQA
Query Conservation    

  

  

  
     
     

   
Alig confidence 






......





.










Template Conservation 
  



......




 .

 





 
Template Sequence  PRRGAEL. . . . . . VARAWT. DPEFRQLLLTD
Template Known Secondary structure  .......

Template Predicted Secondary structure 


......

.

Template SS confidence 






























   54.....60 ...... ...70.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions