Return to main results Retrieve Phyre Job Id

Job DescriptionP45751
Confidence13.76%DateThu Jan 5 12:03:30 GMT 2012
Rank5Aligned Residues25
% Identity44%Templated1ikpa2
SCOP infoADP-ribosylation ADP-ribosylation ADP-ribosylating toxins
Resolution1.45

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   92.......100.........110.........120....
Predicted Secondary structure 













Query SS confidence 
































Query Sequence  PSAQGGELALKTLWEAVPSAFTRLAERNVSVSR
Query Conservation 

  





   
  

 

  


  
 
  
Alig confidence 














........









Template Conservation 














........









Template Sequence  PEEEGGRLETILGWP. . . . . . . . LAERTVVIPS
Template Known Secondary structure  SSTT


........T

Template Predicted Secondary structure 








........





Template SS confidence 
































   545....550......... 560.........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions