Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABN9
Confidence53.91%DateThu Jan 5 11:15:58 GMT 2012
Rank1Aligned Residues39
% Identity21%Templated1zbsa1
SCOP infoRibonuclease H-like motif Actin-like ATPase domain BadF/BadG/BcrA/BcrD-like
Resolution2.30

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   106...110.........120.........130.........140.........150......
Predicted Secondary structure 






Query SS confidence 


















































Query Sequence  TGHVVYTILPIIYDVAIKNNIRPERPMAASSIGAQMGIIASPVSVAVVSLV
Query Conservation 

 
  





 


   








 





 

 







  
 
Alig confidence 
























............













Template Conservation 




      
             ............
   
  


 
  
Template Sequence  IGSVAFHYREVLSSVIKKRGLTLGS. . . . . . . . . . . . VLQSPXEGLIQYHH
Template Known Secondary structure  STTT

............S
S
Template Predicted Secondary structure 








............



Template SS confidence 


















































   241........250.........260..... ....270.........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions