Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABN9
Confidence25.50%DateThu Jan 5 11:15:58 GMT 2012
Rank12Aligned Residues23
% Identity43%Templatec3pzfA_
PDB info PDB header:hydrolase inhibitorChain: A: PDB Molecule:serpin 2; PDBTitle: 1.75a resolution structure of serpin-2 from anopheles gambiae
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   400......... 410... ......420..
Predicted Secondary structure 




.....



...






Query SS confidence 









. . . . .



. . .








Query Sequence  AAIQFDRSGT. . . . . THIG. . . RFVINHSFI
Query Conservation 


 

 


.....



...
 
 




Alig confidence 









.....



...








Template Conservation    
 
 
 
  
 
 
       
  



 
Template Sequence  AGITINELGSEAYAATEIDGVQIFNANRPFI
Template Known Secondary structure 
SSS



S






S
Template Predicted Secondary structure 

















Template SS confidence 






























   349350.........360.........370.........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions