Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABN9
Confidence9.07%DateThu Jan 5 11:15:58 GMT 2012
Rank66Aligned Residues23
% Identity26%Templatec2wsfF_
PDB info PDB header:photosynthesisChain: F: PDB Molecule:photosystem i reaction center subunit iii, PDBTitle: improved model of plant photosystem i
Resolution3.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   394.....400.........410.........420.......
Predicted Secondary structure 




















Query SS confidence 

































Query Sequence  TYPSDLAAIQFDRSGTTHIGRFVINHSFILPGLI
Query Conservation   


 



 

 







 
 









Alig confidence 















...........






Template Conservation 





 

   



...........
 

 

Template Sequence  GLPHLIVSGDQRHWGE. . . . . . . . . . . FITPGIL
Template Known Secondary structure 






SSSSS

TT...........TS
Template Predicted Secondary structure 







...........
Template SS confidence 

































   67..70.........80.. .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions