Return to main results Retrieve Phyre Job Id

Job DescriptionP32664
Confidence71.70%DateThu Jan 5 11:49:56 GMT 2012
Rank151Aligned Residues27
% Identity37%Templatec3gn5B_
PDB info PDB header:dna binding proteinChain: B: PDB Molecule:hth-type transcriptional regulator mqsa (ygit/b3021); PDBTitle: structure of the e. coli protein mqsa (ygit/b3021)
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   98.100......... 110.........120....
Predicted Secondary structure 









................









Query SS confidence 











. . . . . . . . . . . . . . . .














Query Sequence  CGYCGHEMYPSK. . . . . . . . . . . . . . . . TEWAMLCSHCRERYY
Query Conservation 
  

       ................      
  
    
Alig confidence 











................














Template Conservation 

 

               

    
       
  


   
Template Sequence  CPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIM
Template Known Secondary structure 
TTTSSSBTTTTT


Template Predicted Secondary structure 

















Template SS confidence 










































   3......10.........20.........30.........40.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions