Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABE2
Confidence15.81%DateThu Jan 5 11:15:17 GMT 2012
Rank15Aligned Residues34
% Identity29%Templatec2hw4A_
PDB info PDB header:structural genomics, hydrolaseChain: A: PDB Molecule:14 kda phosphohistidine phosphatase; PDBTitle: crystal structure of human phosphohistidine phosphatase
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4950.........60.........70 .........80.........90.........100....
Predicted Secondary structure 





.



















Query SS confidence 





















.

































Query Sequence  TGERFLNRHRMIYSTLAEELST. TVHALALHTYTIKEWEGLQDTVFASPPCRGAGSI
Query Conservation   
 
 
 


 

  
  

  . 







 

 

         

 
 
    
Alig confidence 





















.




......................






Template Conservation 

     

 

      

   

   ......................






Template Sequence  RGYKWAEYHADIYDKVSGDMQKQGCDCE. . . . . . . . . . . . . . . . . . . . . . CLGGGRI
Template Known Secondary structure 
TT
SSTT
......................
Template Predicted Secondary structure 







......................

Template SS confidence 
























































   45....50.........60.........70.. .......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions