Return to main results Retrieve Phyre Job Id

Job DescriptionP77285
Confidence2.44%DateThu Jan 5 12:27:13 GMT 2012
Rank79Aligned Residues25
% Identity28%Templatec1ybxA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:conserved hypothetical protein; PDBTitle: conserved hypothetical protein cth-383 from clostridium thermocellum
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   92.......100.........110.........120.
Predicted Secondary structure 









Query SS confidence 





























Query Sequence  LEATAPDGYSGAIQLLVGADFNGTVLGTRV
Query Conservation 
      

 
 
   
 

 

 
 

 
Alig confidence 








.....















Template Conservation      
  
 .....
 


 
 
 
  
 
Template Sequence  VEASAGGGA. . . . . VTVVATGRKDIKEITI
Template Known Secondary structure  TTTT.....TT

Template Predicted Secondary structure 


.....

Template SS confidence 





























   3940....... ..50.........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions