Return to main results Retrieve Phyre Job Id

Job DescriptionP00579
Confidence48.40%DateThu Jan 5 10:56:46 GMT 2012
Rank321Aligned Residues43
% Identity26%Templatec3edpB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:lin2111 protein; PDBTitle: the crystal structure of the protein lin2111 (functionally unknown)2 from listeria innocua clip11262
Resolution2.09 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   432.......440.........450.........460.........470.........480.........490.........
Predicted Secondary structure 













Query SS confidence 



































































Query Sequence  TWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLK
Query Conservation     
   
             
                     
      
 
               
Alig confidence 
















...

.....................
.






















Template Conservation 
 

   
   
  
  ...  .....................
.



 


    


 


 

 
Template Sequence  FEVIASKIKDSINRDEY. . . KT. . . . . . . . . . . . . . . . . . . . . G. XPNETALQEIYSSSRTTIRRAVD
Template Known Secondary structure  TTSS...

.....................
.


TT

Template Predicted Secondary structure 



...

.....................
.





Template SS confidence 



































































   8.10.........20.... .. . ..30.........40.........50
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions