Return to main results Retrieve Phyre Job Id

Job DescriptionP00579
Confidence92.03%DateThu Jan 5 10:56:46 GMT 2012
Rank73Aligned Residues46
% Identity11%Templatec2o38A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein; PDBTitle: putative xre family transcriptional regulator
Resolution1.83 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   529530.........540.........550.........560.........570.........580.........590..
Predicted Secondary structure 
















Query SS confidence 































































Query Sequence  ELPLDSATTESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEA
Query Conservation                 
      
   
  
                

         

 
   
Alig confidence 




















..................
























Template Conservation 
 
     
  
   
   
 ..................  



  

   


   

 

 
Template Sequence  PDAEERQTKLRLAYALNAVID. . . . . . . . . . . . . . . . . . RARLSQAAAAARLGINQPKVSALRN
Template Known Secondary structure 
..................TT

T

T
Template Predicted Secondary structure 

..................






Template SS confidence 































































   28.30.........40........ .50.........60.........70...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions