Return to main results Retrieve Phyre Job Id

Job DescriptionP00579
Confidence58.58%DateThu Jan 5 10:56:46 GMT 2012
Rank266Aligned Residues46
% Identity22%Templatec1e2xA_
PDB info PDB header:transcriptional regulationChain: A: PDB Molecule:fatty acid metabolism regulator protein; PDBTitle: fadr, fatty acid responsive transcription factor from e.2 coli
Resolution2.0 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   428.430.........440.........450.........460.........470.........480.........490.........500
Predicted Secondary structure 













Query SS confidence 








































































Query Sequence  STYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKI
Query Conservation   


   
   
             
                     
      
 
                
Alig confidence 



















...........................

























Template Conservation 
  
   
   
  
 
 

...........................  



  

   



 





  
Template Sequence  AGFAEEYIIESIWNNRFPPG. . . . . . . . . . . . . . . . . . . . . . . . . . . TILPAERELSELIGVTRTTLREVLQR
Template Known Secondary structure  TTSS
TT...........................SB


T

Template Predicted Secondary structure 






...........................







Template SS confidence 








































































   910.........20........ .30.........40.........50....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions