Return to main results Retrieve Phyre Job Id

Job DescriptionP77858
Confidence1.85%DateWed Jan 25 15:21:12 GMT 2012
Rank90Aligned Residues38
% Identity11%Templated1eysl_
SCOP infoBacterial photosystem II reaction centre, L and M subunits Bacterial photosystem II reaction centre, L and M subunits Bacterial photosystem II reaction centre, L and M subunits
Resolution2.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40..... ....50....
Predicted Secondary structure 




................
Query SS confidence 




























. . . . . . . . . . . . . . . .








Query Sequence  QAVILLMLTPLFTGISRQIRARMHSRRGP. . . . . . . . . . . . . . . . GIWQDYRDI
Query Conservation    
  
    
    



 
  
 
 

................



   
 
Alig confidence 




























................








Template Conservation   

 

  



 
  
 

 
  



 


 

 


    

  



 

Template Sequence  QIITICAAGAFISWALREVEICRKLGIGFHVPFAFSFAIGAYLVLVFVRPLLMG
Template Known Secondary structure  TTT


TT
Template Predicted Secondary structure 






Template SS confidence 





















































   95....100.........110.........120.........130.........140........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions