Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADT2
Confidence3.99%DateWed Jan 25 15:20:29 GMT 2012
Rank29Aligned Residues34
% Identity29%Templatec3c9pA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein sp1917; PDBTitle: crystal structure of uncharacterized protein sp1917
Resolution1.96 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60.........70.........80...
Predicted Secondary structure 




















Query SS confidence 





















































Query Sequence  TVFMLAGCEKSDETVSLYQNADDCSAANPGKSAECTTAYNNALKEAERTAPKYA
Query Conservation 
 
 



    
    
 
  

  
       
  

  
  
   




 
Alig confidence 










........













............








Template Conservation 

 




   ........ 
   
      
 ............


 

  
Template Sequence  VTSWLTGYEVS. . . . . . . . DVLACLDRDVTYGD. . . . . . . . . . . . FFRQAPYYV
Template Known Secondary structure 


........TTS

B............T
S


Template Predicted Secondary structure 


........



............




Template SS confidence 





















































   34.....40.... .....50........ .60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions