Return to main results Retrieve Phyre Job Id

Job DescriptionP0AG18
Confidence66.06%DateThu Jan 5 11:27:51 GMT 2012
Rank101Aligned Residues63
% Identity22%Templated1u0ta_
SCOP infoNAD kinase/diacylglycerol kinase-like NAD kinase/diacylglycerol kinase-like NAD kinase-like
Resolution2.30

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20. ........30.........40.........50.........60.........70.........80....
Predicted Secondary structure 




..

















..
Query SS confidence 












. .






























































. .
Query Sequence  RVAIVMGSKSDWA. . TMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKT. .
Query Conservation   
 

 

 


 ..    
   

  

  

 
 



 
  
             



 

  







  
..
Alig confidence 












..


















.....................





.















..
Template Conservation   
 

              
   
   
      .....................  
 

. 





 
  
      
Template Sequence  SVLLVVHTGRDEATETARRVEKVLGDNKIALRVL. . . . . . . . . . . . . . . . . . . . . SCELVL. VLGGDGTFLRAAELARNA
Template Known Secondary structure  SSSGGGGSTTT
.....................



.
Template Predicted Secondary structure 







.....................


.





Template SS confidence 















































































   6...10.........20.........30......... 40..... ....50.........60...
 
   85....90...
Predicted Secondary structure 



Query SS confidence 








Query Sequence  LVPVLGVPV
Query Conservation    





 
Alig confidence 








Template Conservation   






 
Template Sequence  SIPVLGVNL
Template Known Secondary structure  T


Template Predicted Secondary structure 



Template SS confidence 








   99100.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions