Return to main results Retrieve Phyre Job Id

Job DescriptionP0AG18
Confidence49.84%DateThu Jan 5 11:27:51 GMT 2012
Rank167Aligned Residues47
% Identity23%Templatec3o8oB_
PDB info PDB header:transferaseChain: B: PDB Molecule:6-phosphofructokinase subunit beta; PDBTitle: structure of phosphofructokinase from saccharomyces cerevisiae
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   46...50.........60.........70. ..... ...80.... .....90..
Predicted Secondary structure 






...


......

..............


Query SS confidence 

























. . .




. . . . . .







. . . . . . . . . . . . . .







Query Sequence  RTPDKLFSFAESAEENGYQVIIAGAG. . . GAAHL. . . . . . PGMIAAKT. . . . . . . . . . . . . . LVPVLGVP
Query Conservation 
 
  
             



 

...  


......




  
..............  





Alig confidence 

























...




......







..............







Template Conservation              
    
  








   
  
          
     
  
       
 




Template Sequence  KKREGRLLGAQHLIEAGVDALIVCGGDGSLTGADLFRSEWPSLIEELLKTNRISNEQYERMKHLNICGTV
Template Known Secondary structure  GST


TTSSS
T


Template Predicted Secondary structure 


















Template SS confidence 





































































   275....280.........290.........300.........310.........320.........330.........340....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions