Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8T7
Confidence23.26%DateWed Jan 25 15:20:19 GMT 2012
Rank55Aligned Residues29
% Identity17%Templatec3imkA_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:putative molybdenum carrier protein; PDBTitle: crystal structure of putative molybdenum carrier protein (yp_461806.1)2 from syntrophus aciditrophicus sb at 1.45 a resolution
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   788.790.........800.........810.........820.........
Predicted Secondary structure 











Query SS confidence 









































Query Sequence  LKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGG
Query Conservation 



 





 


 



 
 

 


 
 
 



 

 
Alig confidence 











............











.




Template Conservation   
     
  

............  

 


 


.   
 
Template Sequence  QEXPTSDYSKRT. . . . . . . . . . . . EKNVLDSDGTLI. ISHGI
Template Known Secondary structure 
SS

............TSS.SSS
Template Predicted Secondary structure 





............


.

Template SS confidence 









































   55....60...... ...70........ .80...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions