Return to main results Retrieve Phyre Job Id

Job DescriptionP69826
Confidence22.02%DateThu Jan 5 12:12:09 GMT 2012
Rank112Aligned Residues34
% Identity24%Templatec3s3lB_
PDB info PDB header:transferaseChain: B: PDB Molecule:cerj; PDBTitle: crystal structure of cerj from streptomyces tendae
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   377..380.........390.........400.........410.........420.
Predicted Secondary structure 















Query SS confidence 












































Query Sequence  CDAGMGSSAMGATTFRKRLEKAGLAIEVKHYAIENVPADADIVVT
Query Conservation 











               
                 
Alig confidence 
























...........








Template Conservation      
    

  

  

  

  ...........
 


 

 
Template Sequence  DAEEDAPPRMAARAARAALGRGDVD. . . . . . . . . . . PADVSLVLH
Template Known Secondary structure  SSGGGST

...........GGG
Template Predicted Secondary structure 









...........

Template SS confidence 












































   48.50.........60.........70.. .......80.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions