Return to main results Retrieve Phyre Job Id

Job DescriptionP64442
Confidence1.46%DateThu Jan 5 12:08:21 GMT 2012
Rank88Aligned Residues37
% Identity30%Templatec2ig7A_
PDB info PDB header:transferaseChain: A: PDB Molecule:choline/ethanolamine kinase; PDBTitle: crystal structure of human choline kinase b
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10 .........20.........30........
Predicted Secondary structure 
.............
Query SS confidence 








. . . . . . . . . . . . .



























Query Sequence  RPFLQEYLM. . . . . . . . . . . . . RRLLHYLINNIREHLMLYLFLWGLLAIM
Query Conservation 








.............


    




 
 


 


 



 
Alig confidence 








.............



























Template Conservation    
   
                     
   
      
 
 
 


 
Template Sequence  LHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSIL
Template Known Secondary structure  TTT



Template Predicted Secondary structure 









Template SS confidence 

















































   310.........320.........330.........340.........350.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions