Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD17
Confidence2.71%DateWed Jan 25 15:20:24 GMT 2012
Rank61Aligned Residues25
% Identity48%Templated1q90g_
SCOP infoSingle transmembrane helix PetG subunit of the cytochrome b6f complex PetG subunit of the cytochrome b6f complex
Resolution3.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   118.120.........130.........140........
Predicted Secondary structure 
Query SS confidence 






























Query Sequence  FLSGLVALYPLVWLCALVGTVALFYTGYLLY
Query Conservation   
 

  
 
 
     
 


  

 



Alig confidence 






...

...















Template Conservation   
 



...

...



 










Template Sequence  LLCGIVL. . . GL. . . VPVTIAGLFVTAYLQY
Template Known Secondary structure  ......
Template Predicted Secondary structure  ......
Template SS confidence 






























   5....10. .. ......20.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions