Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC35
Confidence17.97%DateThu Jan 5 11:17:05 GMT 2012
Rank37Aligned Residues29
% Identity34%Templated2dexx3
SCOP infoPentein, beta/alpha-propeller Pentein Peptidylarginine deiminase Pad4, catalytic C-terminal domain
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   160.........170.........180.........190.........200
Predicted Secondary structure 











Query SS confidence 








































Query Sequence  FGPLIVSIDTHGNNLIAENKKLFAERRDPIVEEICEHVHYI
Query Conservation 


 





 

 

                         
Alig confidence 




.....







.......















Template Conservation   



..... 
 
  

....... 
       
  
 

Template Sequence  FGPVI. . . . . NGRCCLEE. . . . . . . KVCSLLEPLGLQCTFI
Template Known Secondary structure 


.....TT.......GGGT
Template Predicted Secondary structure 




.....

.......


Template SS confidence 








































   602.... ...610.... .....620.........630
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions