Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC35
Confidence9.85%DateThu Jan 5 11:17:05 GMT 2012
Rank63Aligned Residues36
% Identity19%Templatec3qd7X_
PDB info PDB header:hydrolaseChain: X: PDB Molecule:uncharacterized protein ydal; PDBTitle: crystal structure of ydal, a stand-alone small muts-related protein2 from escherichia coli
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   96...100.... .....110....... ..120.... .....130.
Predicted Secondary structure 


........


..

...

Query SS confidence 








. . . . . . . .












. .






. . .






Query Sequence  VKLVVGKGG. . . . . . . . MGPLTEEGCQKFK. . ALHVIFP. . . AGCAVLA
Query Conservation 
   



 ........       
 
  
..



   ...






Alig confidence 








........












..






...






Template Conservation 
 





  
     


  
   
     
  
  
    

 

  
Template Sequence  VLIIHGKGRDDKSHANIVRSYVARWLTEFDDVQAYCTALPHHGGSGACY
Template Known Secondary structure 



SSTTSTSTT

GGGTGGG
Template Predicted Secondary structure 






















Template SS confidence 
















































   117..120.........130.........140.........150.........160.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions