Return to main results Retrieve Phyre Job Id

Job DescriptionQ9JMR4
Confidence3.61%DateThu Jan 5 12:37:48 GMT 2012
Rank10Aligned Residues36
% Identity42%Templatec3tixA_
PDB info PDB header:gene regulation/protein bindingChain: A: PDB Molecule:ubiquitin-like protein smt3, rna-induced transcriptional PDBTitle: crystal structure of the chp1-tas3 complex core
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   66...70.........80.........90.........100.........110.......
Predicted Secondary structure 

































Query SS confidence 



















































Query Sequence  GGLPSLTRNPGLQRPFRSRRLCRAVACAPGIPAKGRRDVRGNAVSQTALHVV
Query Conservation 

















 














 




 



 


 

Alig confidence 





................





























Template Conservation 

    ................                              
Template Sequence  GGLPSL. . . . . . . . . . . . . . . . PFLACISDFPENHGTSRRSATVSLERVHEL
Template Known Secondary structure  TTGGG................




SS



Template Predicted Secondary structure 





................


Template SS confidence 



















































   7..10.. .......20.........30.........40..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions