Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9Q5
Confidence43.99%DateThu Jan 5 11:10:59 GMT 2012
Rank188Aligned Residues25
% Identity24%Templatec3gn5B_
PDB info PDB header:dna binding proteinChain: B: PDB Molecule:hth-type transcriptional regulator mqsa (ygit/b3021); PDBTitle: structure of the e. coli protein mqsa (ygit/b3021)
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40 .........50
Predicted Secondary structure 





...............






Query SS confidence 














. . . . . . . . . . . . . . .









Query Sequence  KCDSCGQVLYRAELE. . . . . . . . . . . . . . . RNLEVCPKCD
Query Conservation 

  
        
 ............... 
  


 
 
Alig confidence 














...............









Template Conservation 


 

               

    
       
  

Template Sequence  KCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCE
Template Known Secondary structure  B
TTTSSSBTTTTT
Template Predicted Secondary structure 

















Template SS confidence 







































   2.......10.........20.........30.........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions