Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9Q5
Confidence41.41%DateThu Jan 5 11:10:59 GMT 2012
Rank196Aligned Residues20
% Identity30%Templatec2y0fD_
PDB info PDB header:oxidoreductaseChain: D: PDB Molecule:4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; PDBTitle: structure of gcpe (ispg) from thermus thermophilus hb27
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30...... ...40...
Predicted Secondary structure 





..........
Query SS confidence 












. . . . . . . . . .






Query Sequence  WTKCDSCGQVLYR. . . . . . . . . . AELERNL
Query Conservation 
 

  
      ..........  
  
 
Alig confidence 












..........






Template Conservation   








  

    
  
   
    
Template Sequence  VTSCPGCGRTTSTFFQELAEEVSRRLKERL
Template Known Secondary structure 



SS



Template Predicted Secondary structure 





Template SS confidence 





























   294.....300.........310.........320...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions