Return to main results Retrieve Phyre Job Id

Job DescriptionP24174
Confidence40.57%DateThu Jan 5 11:40:50 GMT 2012
Rank230Aligned Residues49
% Identity18%Templatec2fkdK_
PDB info PDB header:transcription regulatorChain: K: PDB Molecule:repressor protein ci; PDBTitle: crystal structure of the c-terminal domain of bacteriophage2 186 repressor
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   324.....330.........340.........350.........360.........370.........380.........390........
Predicted Secondary structure 


























Query SS confidence 










































































Query Sequence  GVKDLVVVQTKDAVLIADRNAVQDVKKVVEQIKADGRHEHRVHREVYRPWGKYDSIDAGDRYQVKRITVKPGEGL
Query Conservation 

 




 
 

 

  
   
 

 

  
          
    



    
       

 
 
 

  
Alig confidence 





















.........................



.






















Template Conservation      
  
 
     


    .........................
 

. 


 


 
 









 
Template Sequence  PLTDGMAIRSEGKIYFVDKQAS. . . . . . . . . . . . . . . . . . . . . . . . . LSDG. LWLVDIEGAISIRELTKLPGRKL
Template Known Secondary structure 


STTTT

.........................

S.TTTTT
Template Predicted Secondary structure 











.........................



.





Template SS confidence 










































































   114.....120.........130..... .... 140.........150.........160..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions