Return to main results Retrieve Phyre Job Id

Job DescriptionP23482
Confidence7.32%DateThu Jan 5 11:39:28 GMT 2012
Rank59Aligned Residues25
% Identity52%Templatec3kdpH_
PDB info PDB header:hydrolaseChain: H: PDB Molecule:na+/k+ atpase gamma subunit transcript variant a; PDBTitle: crystal structure of the sodium-potassium pump
Resolution3.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   306...310.........320.........330.........340.......
Predicted Secondary structure 





Query SS confidence 









































Query Sequence  WSTVENVGIILLAVGVAMVGLSLHDPLLTVVGLLGALFHLLN
Query Conservation 





 
 
   

            
       

 
 
 
Alig confidence 













.................










Template Conservation 











 
.................





 



Template Sequence  YETVRNGGLIFAAL. . . . . . . . . . . . . . . . . AFIVGLIILLS
Template Known Secondary structure 
.................TT
Template Predicted Secondary structure 








.................
Template SS confidence 









































   23......30...... ...40.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions