Return to main results Retrieve Phyre Job Id

Job DescriptionP05050
Confidence12.77%DateThu Jan 5 10:58:38 GMT 2012
Rank33Aligned Residues37
% Identity19%Templatec3uyjA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:lysine-specific demethylase 8; PDBTitle: crystal structure of jmjd5 catalytic core domain in complex with2 nickle and alpha-kg
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   161........170.........180.........190.........200.........
Predicted Secondary structure 



























Query SS confidence 
















































Query Sequence  RNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTF
Query Conservation         
 
  





 
 

 
 


              





Alig confidence 


















...











.........





Template Conservation           
 


 



... 

 
 
     .........



  
Template Sequence  AKAPFLSCILSPGEILFIP. . . VKYWHYVRALDL. . . . . . . . . SFSVSF
Template Known Secondary structure  TT



TT

...TT
SSS.........
Template Predicted Secondary structure 







...





.........
Template SS confidence 
















































   377..380.........390..... ....400....... ..410...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions