Return to main results Retrieve Phyre Job Id

Job DescriptionP66899
Confidence23.07%DateThu Jan 5 12:10:21 GMT 2012
Rank219Aligned Residues45
% Identity24%Templatec2rghA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:alpha-glycerophosphate oxidase; PDBTitle: structure of alpha-glycerophosphate oxidase from2 streptococcus sp.: a template for the mitochondrial alpha-3 glycerophosphate dehydrogenase
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   75....80.........90.........100.........110.........120.........130.........140.
Predicted Secondary structure 





















Query SS confidence 


































































Query Sequence  AFKMLGGAYAIAQLLCEKYHLDIETLSFEHLKNAIGEKMTFATTTDGNHGRGVAWAAQQLGQNAVIY
Query Conservation 


 

    
  
                          

 




 
 
 
  
   
    

Alig confidence 







..









....................


























Template Conservation      
   ..        

....................







 


 
  

  
  
 

Template Sequence  SNKTRQDS. . IQKXQQEELD. . . . . . . . . . . . . . . . . . . . LLIIGGGITGAGVAVQAAASGIKTGLI
Template Known Secondary structure  S..S
BS....................

STT

Template Predicted Secondary structure 
..



....................





Template SS confidence 


































































   3......10 .........20 .........30.........40.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions