Return to main results Retrieve Phyre Job Id

Job DescriptionP77624
Confidence38.54%DateThu Jan 5 12:31:13 GMT 2012
Rank46Aligned Residues34
% Identity29%Templatec4a1aI_
PDB info PDB header:ribosomeChain: I: PDB Molecule:60s ribosomal protein l13a; PDBTitle: t.thermophila 60s ribosomal subunit in complex with2 initiation factor 6. this file contains 5s rrna,3 5.8s rrna and proteins of molecule 3.
Resolution3.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50
Predicted Secondary structure 
















Query SS confidence 

















































Query Sequence  MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDYDIVLT
Query Conservation 
 
 



 


 
               
  
   
  
   
  



Alig confidence 













................



















Template Conservation    
 




   

................




 


 




 



Template Sequence  FDKLVVIDAKGHLL. . . . . . . . . . . . . . . . GRLASYVAKELLSGQRIVVV
Template Known Secondary structure 
SS

TTBB................TT

Template Predicted Secondary structure 






................


Template SS confidence 

















































   2.......10..... ....20.........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions