Return to main results Retrieve Phyre Job Id

Job DescriptionP77624
Confidence21.00%DateThu Jan 5 12:31:13 GMT 2012
Rank56Aligned Residues34
% Identity26%Templatec3izcK_
PDB info PDB header:ribosomeChain: K: PDB Molecule:60s ribosomal protein rpl16 (l13p); PDBTitle: localization of the large subunit ribosomal proteins into a 6.1 a2 cryo-em map of saccharomyces cerevisiae translating 80s ribosome
ResolutionNULL Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50
Predicted Secondary structure 
















Query SS confidence 

















































Query Sequence  MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDYDIVLT
Query Conservation 
 
 



 


 
               
  
   
  
   
  



Alig confidence 













................



















Template Conservation      




   

................




 


 

 

 



Template Sequence  VEPVVVIDGKGHLV. . . . . . . . . . . . . . . . GRLASVVAKQLLNGQKIVVV
Template Known Secondary structure  SSS


TTBB................TT

Template Predicted Secondary structure 






................


Template SS confidence 

















































   3......10...... ...20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions