Return to main results Retrieve Phyre Job Id

Job DescriptionP77624
Confidence13.72%DateThu Jan 5 12:31:13 GMT 2012
Rank73Aligned Residues32
% Identity25%Templatec3d54D_
PDB info PDB header:ligaseChain: D: PDB Molecule:phosphoribosylformylglycinamidine synthase 1; PDBTitle: stucture of purlqs from thermotoga maritima
Resolution3.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1.... .... 10.........20.........30.........40.........50.
Predicted Secondary structure 


..













Query SS confidence 




.



.









































Query Sequence  MKELV. VVAI. GGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDYDIVLTH
Query Conservation 
 
 
.


 .


 
               
  
   
  
   
  




Alig confidence 




.



.






...................















Template Conservation    
 
 

   
      ...................   

  

     
 
Template Sequence  MKPRACVVVYPGSNCDRD. . . . . . . . . . . . . . . . . . . AYHALEINGFEPSYVG
Template Known Secondary structure 




TT...................TTT

Template Predicted Secondary structure 









...................



Template SS confidence 




















































   1........10........ .20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions