Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8S9
Confidence4.24%DateThu Jan 5 11:08:38 GMT 2012
Rank25Aligned Residues36
% Identity25%Templatec2q9lA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:hypothetical protein; PDBTitle: crystal structure of imazg from vibrio dat 722: ctag-imazg (p43212)
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.......
Predicted Secondary structure 





Query SS confidence 














































Query Sequence  MHTSELLKHIYDINLSYLLLAQRLIVQDKASAMFRLGINEEMATTLA
Query Conservation 
    

 

 
 












 
 
 
 





 



 
 
Alig confidence 
















..........






.











Template Conservation 
 
 


  
       ..........       .
 
 





 
Template Sequence  MKLSELQSHIKEFDYAP. . . . . . . . . . EQSEHYF. FKLIEEVGELSE
Template Known Secondary structure 




G..........GG.
Template Predicted Secondary structure 





..........

.
Template SS confidence 














































   1........10....... ..20.... .....30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions