Return to main results Retrieve Phyre Job Id

Job DescriptionP32128
Confidence5.70%DateThu Jan 5 11:49:13 GMT 2012
Rank77Aligned Residues29
% Identity24%Templatec2yglA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:blood group a-and b-cleaving endo-beta-galactosidase; PDBTitle: the x-ray crystal structure of tandem cbm51 modules of sp3gh98, the2 family 98 glycoside hydrolase from streptococcus pneumoniae3 sp3-bs71
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   44.....50.... .....60..... ....70..
Predicted Secondary structure 





.........
Query SS confidence 










. . . .










. . . . .






Query Sequence  KKGEHAYDMTL. . . . SYQNFDKGFFN. . . . . SRFQMQM
Query Conservation            
....    



 

.....
 
   
Alig confidence 










....










.....






Template Conservation        
 
 
   
   

 






 
 
 
 


Template Sequence  GNNGSNNKIKLLIDGKEVEFNKGLGTVASNPSSIKYDV
Template Known Secondary structure  TT



TTSS


BSS
Template Predicted Secondary structure 















Template SS confidence 





































   279280.........290.........300.........310......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions