Return to main results Retrieve Phyre Job Id

Job DescriptionP76072
Confidence14.19%DateThu Jan 5 12:18:11 GMT 2012
Rank64Aligned Residues43
% Identity26%Templatec3njqB_
PDB info PDB header:viral protein/inhibitorChain: B: PDB Molecule:orf 17; PDBTitle: crystal structure of kaposi's sarcoma-associated herpesvirus protease2 in complex with dimer disruptor
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   60.........70.........80.........90.........100.........110.........120..
Predicted Secondary structure 
























Query SS confidence 






























































Query Sequence  VILLVEGFPPSHAGTITVYEDSQPGTLNDFLGAMTEDDARPEALRRFELMVEEVARNASAVAQ
Query Conservation                           
         
     
           
     
   
Alig confidence 







...











.................






















Template Conservation 



 


...








   ................. 


  
  

   
  
   
 
Template Sequence  VSLCALGR. . . RRGTVAVYGHDA. . . . . . . . . . . . . . . . . EWVVSRFSSVSKSERAHILQHVS
Template Known Secondary structure  SSS
...SSS


SS.................T
SSS
Template Predicted Secondary structure 


...





.................



Template SS confidence 






























































   135....140.. .......150.... .....160.........170.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions